PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_13510
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family HB-PHD
Protein Properties Length: 672aa    MW: 77125.2 Da    PI: 8.9299
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_13510genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox34.24.5e-11455499953
                 HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHH CS
    Homeobox   9 keqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRa 53 
                 ++ +e L + F++n  ps+  +e L+k+lg++ +++  WF+N R+
  PEQU_13510 455 PDAIEKLRQIFHENELPSRPVKENLSKQLGISVEKIDKWFKNTRY 499
                 7889****************************************7 PP

2PHD31.54e-11218271151
                 SBTTTSS..TCTTSSEEEBS.SSSSEEETTTSTSSSSHHSHHSSTBSSHHHHTT CS
         PHD   1 rCkvCgk..sdeegelvlCd.gCkewfHlkClglkleseekpegewlCeeCkek 51 
                 +C+ C++  + ++++++lCd +C+  fH+kCl+++le+ +  ++ wlC+ C++k
  PEQU_13510 218 FCAKCKSpeAFHDNDIILCDgNCNCGFHQKCLEPPLEKIPPGDQGWLCKVCNCK 271
                 699****66556********66***************8888888*******975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF579032.06E-13210273IPR011011Zinc finger, FYVE/PHD-type
Gene3DG3DSA:3.30.40.101.9E-11214272IPR013083Zinc finger, RING/FYVE/PHD-type
PROSITE profilePS5001610.585216271IPR019787Zinc finger, PHD-finger
CDDcd155044.35E-27218268No hitNo description
PfamPF006281.3E-8218271IPR019787Zinc finger, PHD-finger
SMARTSM002492.3E-6218269IPR001965Zinc finger, PHD-type
PROSITE patternPS013590219268IPR019786Zinc finger, PHD-type, conserved site
PROSITE profilePS5007112.163444504IPR001356Homeobox domain
SuperFamilySSF466894.71E-11446510IPR009057Homeodomain-like
SMARTSM003891.4E-11446508IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.5E-11446498IPR009057Homeodomain-like
CDDcd000862.41E-10447508No hitNo description
PfamPF000461.2E-8455499IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 672 aa     Download sequence    Send to blast
MRVPEKKLIG YKSREYFSNE ENSKTVSMPR NPNGIKIVHN KRCYLTPAYR KKRACKRKNN  60
VNGKSIETLK KKFDRNIGKC ISSLKLTGRK SCFSVGKNSK NLAKSSEKNS VRRRRLKRRK  120
KNIVQDEVSR MQRRARYLLI KMKLEQNLID AYSADGWKGQ SREKIKPEKE LQRAQRQILK  180
FKLGIRDSIH QLDLLGSEGR IEDSVMHPDG SVFHEHIFCA KCKSPEAFHD NDIILCDGNC  240
NCGFHQKCLE PPLEKIPPGD QGWLCKVCNC KMEILDTINA HFGTCFTVNS SWEDIFKEAI  300
VGPDAEGACP NVVEDWPSDD SGDEDYCPDI TQEEFEQSFS DDACCSIDSI FASDASLNFI  360
SCLDSGESVD DITNYRRQRR DVDYKKLYDE MFGKEPNEGV EQSEDEDWGP YRKKKVRIGS  420
DIGITSADGE KDNHVTMALG DMFSCNKRSF FRIPPDAIEK LRQIFHENEL PSRPVKENLS  480
KQLGISVEKI DKWFKNTRYA AIKMKKEETT KHPDHRSDLS MVNEGQRGIS EPALSLDSSC  540
LLPLASIFHL PRHKKRIPRR DNLTYAAFPM KRQKVRSKLR NAARLTKHTV SRDGDLASLK  600
IAAIVPEEEQ VYLNEMQMIW VLERRLHQLK QQLVACKADN EVQVKNLSGE MAVIYVPVAE  660
IKQKSCCEII RS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010929361.10.0PREDICTED: pathogenesis-related homeodomain protein-like
RefseqXP_010929360.10.0PREDICTED: pathogenesis-related homeodomain protein-like
SwissprotP487851e-116PRH_ARATH; Pathogenesis-related homeodomain protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP85502227
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29940.11e-117pathogenesis related homeodomain protein A